PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g005440.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 209aa    MW: 23157.9 Da    PI: 4.9481
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g005440.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB126.41.1e-3959152295
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         re+drf+Pi+nv+rim+k+lP n +is+  k ++qecvsefi+f+t+ea++ cq ++rkti+++dll al  +G++dyve+l +yl++yre
  Solyc05g005440.1.1  59 REHDRFMPITNVIRIMRKILPPNVQISDGFKLMIQECVSEFIGFITGEANNCCQLDQRKTITAEDLLRALDRFGYDDYVETLALYLHRYRE 149
                         89***************************************************************************************** PP

               NF-YB  93 leg 95 
                          +g
  Solyc05g005440.1.1 150 YDG 152
                         876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.8E-3854154IPR009072Histone-fold
SuperFamilySSF471132.26E-3062152IPR009072Histone-fold
PfamPF008085.3E-1864128IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.1E-1092110No hitNo description
PRINTSPR006153.1E-10111129No hitNo description
PRINTSPR006153.1E-10130148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MDDGNLVGSG DGGFHSYCRS PQRTSARSPS PDMEMSLELP AHLEQTIAAN VEHSERTIRE  60
HDRFMPITNV IRIMRKILPP NVQISDGFKL MIQECVSEFI GFITGEANNC CQLDQRKTIT  120
AEDLLRALDR FGYDDYVETL ALYLHRYREY DGGCGSTRRA RLLLRSSMVN PASGCNLTSY  180
QGDASNGSTS QGDAVDIEVQ SPAKETKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-2958149192Transcription factor HapC (Eurofung)
4g92_B2e-2958149192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2040820.0Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0086I08, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010320575.11e-147PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W666e-46NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLK4BW751e-156K4BW75_SOLLC; Uncharacterized protein
STRINGSolyc05g005440.1.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.14e-47nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]